{"product_id":"proteintech-23415-1-ap","title":"Proteintech, 23415-1-AP, NPFFR1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NPFFR1 (23415-1-AP) by Proteintech is a Polyclonal antibody targeting NPFFR1 in WB, ELISA applications with reactivity to human, rat samples\n23415-1-AP targets NPFFR1 in WB, ELISA applications and shows reactivity with human, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: SK-N-SH cells, PC-12 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNPFFR1 (Neuropeptide FF Receptor 1) is primarily focused on its role in various physiological and pathological processes. NPFFR1 is involved in modulating the effects of opioids, including their analgesic properties and side effects. This interaction has led to research into the potential use of NPFFR1 ligands to enhance opioid efficacy and reduce adverse effects (PMID: 32673481). Research suggests that NPFFR1 may have neuroprotective effects, particularly in the context of stroke recovery. It may promote neuronal survival, axonal growth, and reduce inflammation (PMID: 39519132).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag20057 Product name: Recombinant human NPFFR1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 339-430 aa of BC131580 Sequence: GFQAAFRARLCPRPSGSHKEAYSERPGGLLHRRVFVVVRPSDSGLPSESGPSSGAPRPGRLPLRNGRVAHHGLPREGPGCSHLPLTIPAWDI Predict reactive species\nFull Name: neuropeptide FF receptor 1\nCalculated Molecular Weight: 430 aa, 48 kDa\nObserved Molecular Weight: 48-50 kDa\nGenBank Accession Number: BC131580\nGene Symbol: NPFFR1\nGene ID (NCBI): 64106\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen Affinity purified\nUNIPROT ID: Q9GZQ6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887740866729,"sku":"23415-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-23415-1-ap","provider":"Iright","version":"1.0","type":"link"}