{"product_id":"proteintech-23425-1-ap","title":"Proteintech, 23425-1-AP, ADH7 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ADH7 (23425-1-AP) by Proteintech is a Polyclonal antibody targeting ADH7 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n23425-1-AP targets ADH7 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells,  A549 cells,  HEK-293 cells\nPositive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nADH7(Alcohol dehydrogenase class 4 mu\/sigma chain) is also named as gastric alcohol dehydrogenase, retinol dehydrogenase and belongs to the zinc-containing alcohol dehydrogenase family. The ubiquitous expression pattern of ADH7 during embryogenesis has led to the notion that the enzymatic conversion of retinol to retinal occurs more or less uniformly and plays no role in the spatial or temporal regulation of RA synthesis during embryonic development(PMID:17473173). It has 2 isoforms produced by alternative splicing and can exsit as a homodimer(PMID:18479436).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag19340 Product name: Recombinant human ADH7 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 253-349 aa of BC131512 Sequence: ISPKDSTKPISEVLSEMTGNNVGYTFEVIGHLETMIDALASCHMNYGTSVVVGVPPSAKMLTYDPMLLFTGRTWKGCVFGGLKSRDDVPKLVTEFLA Predict reactive species\nFull Name: alcohol dehydrogenase 7 (class IV), mu or sigma polypeptide\nCalculated Molecular Weight: 386 aa, 41 kDa\nObserved Molecular Weight: 45-47 kDa\nGenBank Accession Number: BC131512\nGene Symbol: ADH7\nGene ID (NCBI): 131\nRRID: AB_2879277\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P40394\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869631860905,"sku":"23425-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-23425-1-ap","provider":"Iright","version":"1.0","type":"link"}