{"product_id":"proteintech-23426-1-ap","title":"Proteintech, 23426-1-AP, CBX6 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CBX6 (23426-1-AP) by Proteintech is a Polyclonal antibody targeting CBX6 in WB, IHC, ELISA applications with reactivity to human samples\n23426-1-AP targets CBX6 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, HEK-293 cells,  HeLa cells\nPositive IHC detected in: human skin tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe Chromobox domain (Cbx) gene family, consisting of Polycomb and Heterochromatin Protein 1 genes, involves in transcriptional repression, cell cycle regulation and chromatin remodeling [PMID: 17486619]. Cbx6, other named neuronal pentraxin receptor (NPR), first described as a putative integral membrane pentraxin that interacts with neuronal pentraxin 1 and 2, has also been classified as a Pc protein [PMID: 14647293]. NPR was determined to be a member of a distinct pentraxin protein subfamily, and found to form heteropentamer swithNP1 andNP2, followed by release from cell membranes [PMID: 10748068].\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag20014 Product name: Recombinant human CBX6 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 89-336 aa of BC064900 Sequence: ALRISDVHFSVKPSASASSPKLHSSAAVHRLKKDIRRCHRMSRRPLPRPDPQGGSPGLRPPISPFSETVRIINRKVKPREPKRNRIILNLKVIDKGAGGGGAGQGAGALARPKVPSRNRVIGKSKKFSESVLRTQIRHMKFGAFALYKPPPAPLVAPSPGKAEASAPGPGLLLAAPAAPYDARSSGSSGCPSPTPQSSDPDDTPPKLLPETVSPSAPSWREPEVLDLSLPPESAATSKRAPPEVTAAA Predict reactive species\nFull Name: chromobox homolog 6\nCalculated Molecular Weight: 412 aa, 44 kDa\nObserved Molecular Weight: 55-60 kDa\nGenBank Accession Number: BC064900\nGene Symbol: CBX6\nGene ID (NCBI): 23466\nRRID: AB_2737364\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O95503\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869650866345,"sku":"23426-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-23426-1-ap","provider":"Iright","version":"1.0","type":"link"}