{"product_id":"proteintech-23431-1-ap","title":"Proteintech, 23431-1-AP, CEBPB Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CEBPB (23431-1-AP) by Proteintech is a Polyclonal antibody targeting CEBPB in WB, IHC, IF\/ICC, ELISA applications with reactivity to human,  mouse samples\n23431-1-AP targets CEBPB in WB, IHC, IF\/ICC, CoIP, ChIP, RIP, ELISA applications and shows reactivity with human,  mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HeLa cells,  HepG2 cells\nPositive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCCAAT\/enhancer-binding protein beta (CEBPB), also known as LAP, is a important transcriptional activator in the regulation of genes involved in immune and inflammatory responses. It specifically binds to an IL-1 response element in the IL-6 gene. CEBPb mRNAs possess alternative translation-initiation codons, which result in the formation of truncated forms of the protein.Three variants of CEBPBs have been detected: a 46 kDa full-length liver-enriched transcription-activating protein (LAP1), a 42 kDa LAP2 and a 20 kDa liver-enriched transcription-inhibitory protein (LIP). (PMID:18820298). This antibody is specific to CEBPB.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag20073 Product name: Recombinant human CEBPB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-266 aa of BC007538 Sequence: MQRLVAWDPACLPLPPPPPAFKSMEVANFYYEADCLAAAYGGKAAPAAPPAARPGPRPPAGELGSIGDHERAIDFSPYLEPLGAPQAPAPATATDTFEAAPPAPAPAPASSGQHHDFLSDLFSDDYGGKNCKKPAEYGYVSLGRLGAAKGALHPGCFAPLHPPPPPPPPPAELKAEPGFEPADCKRKEEAGAPGGGAGMAAGFPYALRAYLGYQAVPSGSSGSLSTSSSSSPPGTPSPADAKAPPTACYAGAAPAPSQVKSKAKKT Predict reactive species\nFull Name: CCAAT\/enhancer binding protein (C\/EBP), beta\nCalculated Molecular Weight: 345 aa, 36 kDa\nObserved Molecular Weight: 42 kDa,46 kDa\nGenBank Accession Number: BC007538\nGene Symbol: CEBPB\nGene ID (NCBI): 1051\nRRID: AB_2879278\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P17676\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868839202985,"sku":"23431-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-23431-1-ap","provider":"Iright","version":"1.0","type":"link"}