{"product_id":"proteintech-23614-1-ap","title":"Proteintech, 23614-1-AP, MUC1\/CA15-3 C-terminal Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MUC1\/CA15-3 C-terminal (23614-1-AP) by Proteintech is a Polyclonal antibody targeting MUC1\/CA15-3 C-terminal in WB, IHC, ELISA applications with reactivity to human samples\n23614-1-AP targets MUC1\/CA15-3 C-terminal in WB, IHC, IF, CoIP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: DU 145 cells, PC-3 cells,  BxPC-3 cells,  MCF-7 cells\nPositive IHC detected in: human pancreas cancer tissue, human tonsillitis tissue,  human breast cancer tissue,  human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMUC1 is a type I transmembrane glycoprotein expressed by various epithelial cells of the female reproductive tract, lung, breast, kidney, stomach, and pancreas. MUC1 is transcribed as a large precursor gene product, and upon translation, is cleaved in the endoplasmic reticulum, yielding two subunits: the large extracellular N-terminal subunit (MUC1-N, about 120-200 kDa) and the small cytoplasmic C-terminal subunit (MUC1-C, about 23-30 kDa). Among the known mucins, MUC1 is best studied and plays crucial roles in regulating many cellular properties, including cell proliferation, apoptosis, adhesion, and invasion. MUC1 is overexpressed in a wide range of human epithelial malignancies. This antibody was raised against the C-terminal region of human MUC1, thus it recognizes the 23-30 kDa cytoplasmic MUC1.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag20366 Product name: Recombinant human CA15-3,MUC1 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1055-1255 aa of BC120975 Sequence: NSSLEDPSTDYYQELQRDISEMFLQIYKQGGFLGLSNIKFRPGSVVVQLTLAFREGTINVHDVETQFNQYKTEAASRYNLTISDVSVSDVPFPFSAQSGAGVPGWGIALLVLVCVLVALAIVYLIALAVCQCRRKNYGQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSLSYTNPAVAATSANL Predict reactive species\nFull Name: mucin 1, cell surface associated\nCalculated Molecular Weight: 1264 aa, 123 kDa\nObserved Molecular Weight: 23-28 kDa\nGenBank Accession Number: BC120975\nGene Symbol: MUC1\/CA15-3\nGene ID (NCBI): 4582\nRRID: AB_2879304\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P15941\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868907196585,"sku":"23614-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-23614-1-ap","provider":"Iright","version":"1.0","type":"link"}