{"product_id":"proteintech-23631-1-ap","title":"Proteintech, 23631-1-AP, SFMBT1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SFMBT1 (23631-1-AP) by Proteintech is a Polyclonal antibody targeting SFMBT1 in WB, ELISA applications with reactivity to human, mouse, rat samples\n23631-1-AP targets SFMBT1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: IMR-32 cells, mouse testis tissue,  rat testis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nScm-like with four MBT domains protein 1 (SFMBT1) is also named as Renal ubiquitous protein 1 (RU1). SFMBT1 is a transcriptional repressor that associates with chromatin and interacts with the N-terminal tail of histone H3 (PMID: 17599839). SFMBT1 forms a complex with Lys-specific demethylase 1 (LSD1) and they are believed to act together in combination with  RNA polymerase II in the transcriptional regulation of histone genes (PMID: 23592795). SFMBT1 is up-regulated in CRC tumor tissues and cells and may be associated with drug resistance (PMID: 35577773). SFMBT1 regulates the expression and interacts with key genes involved in heart muscle and artery development (PWWP2A, as well as myogenic differentiation (MYOD, SIX2) (PMID: 35483874). Testes, endocrine glands, and blood are tissues that highly express SFMBT1 (PMID: 25613900). SFMBT1 is also highly expressed in skeletal muscles specifically in undifferentiated myoblasts, and this expression starts diminishing during muscle differentiation (PMID: 23349461).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag20417 Product name: Recombinant human SFMBT1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 99-313 aa of BC014614 Sequence: IRKADLYPIGWCEQNKKTLEAPEGIRDKVSDWDEFLRQTLIGACSPPVPLLEGLRNGRNPLDLIAPGSRLECQAFQDSLSTWIVTVVENIGGRLKLRYEGLESSDNYEHWLYYLDPFLHHVGWAAQQGYELQPPSAIRHLKNEAEWQEILAKVKEEEEEPLPSYLFKDKQVIGIHTFSVNMKLEAVDPWSPFGISPATVVKVFDEKYFLVEMDDL Predict reactive species\nFull Name: Scm-like with four mbt domains 1\nCalculated Molecular Weight: 866 aa, 98 kDa\nObserved Molecular Weight: 93-98 kDa\nGenBank Accession Number: BC014614\nGene Symbol: SFMBT1\nGene ID (NCBI): 51460\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen Affinity purified\nUNIPROT ID: Q9UHJ3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887798341801,"sku":"23631-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-23631-1-ap","provider":"Iright","version":"1.0","type":"link"}