{"product_id":"proteintech-23640-1-ap","title":"Proteintech, 23640-1-AP, MRGPRD Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MRGPRD (23640-1-AP) by Proteintech is a Polyclonal antibody targeting MRGPRD in IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples\n23640-1-AP targets MRGPRD in IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: mouse small intestine tissue, rat dorsal root ganglion tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse small intestine tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMRGPRD (MAS-related G-protein coupled receptor, D), also referred to as hGPCR45 or TGR7, was identified as a novel GPCR in murine and human genomes. As for MRGD, its expression was found in dorsal root ganglia (DRG) and co-localized with Vanilloid receptor-1 (VR-1), which is an essential receptor for heat and pain sensation (PMID: 22715397).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag20316 Product name: Recombinant human MRGPRD protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 230-321 aa of BC156660 Sequence: FLICSLPLSIYWFVLYWLSLPPEMQVLCFSLSRLSSSVSSSANPVIYFLVGSRRSHRLPTRSLGTVLQQALREEPELEGGETPTVGTNEMGA Predict reactive species\nFull Name: MAS-related GPR, member D\nCalculated Molecular Weight: 321 aa, 36 kDa\nGenBank Accession Number: BC156660\nGene Symbol: MRGPRD\nGene ID (NCBI): 116512\nRRID: AB_3669414\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen Affinity purified\nUNIPROT ID: Q8TDS7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887723958441,"sku":"23640-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-23640-1-ap","provider":"Iright","version":"1.0","type":"link"}