{"product_id":"proteintech-23762-1-ap","title":"Proteintech, 23762-1-AP, RSK2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RSK2 (23762-1-AP) by Proteintech is a Polyclonal antibody targeting RSK2 in WB, IHC, IF\/ICC, IF-P, IP, ELISA applications with reactivity to human, mouse samples\n23762-1-AP targets RSK2 in WB, IHC, IF\/ICC, IF-P, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: NIH\/3T3 cells, K-562 cells,  MCF-7 cells,  HepG2 cells\nPositive IP detected in: K-562 cells\nPositive IHC detected in: human kidney tissue, mouse colon tissue,  mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse brain tissue\nPositive IF\/ICC detected in: HepG2 cells, HUVEC cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:5000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRPS6KA3(Ribosomal protein S6 kinase alpha-3) is also named as ISPK1, MAPKAPK1B, RSK2 and belongs to the protein kinase superfamily. It localizes at the kinetochores under spindle checkpoint conditions, and during mitosis, associated with the centrosomes, the spindle and at the mid-body(PMID:20383198). It is required for EGF activated phosphorylation of histone H3, which may cause chromatin remodeling and facilitate gene transcription and maybe playing an essential regulatory role in protein synthesis during cell proliferation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag20620 Product name: Recombinant human RPS6KA3 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 666-740 aa of BC096301 Sequence: QRLTAALVLRHPWIVHWDQLPQYQLNRQDAPHLVKGAMAATYSALNRNQSPVLEPVGRSTLAQRRGIKKITSTAL Predict reactive species\nFull Name: ribosomal protein S6 kinase, 90kDa, polypeptide 3\nCalculated Molecular Weight: 740 aa, 84 kDa\nObserved Molecular Weight: 84 kDa\nGenBank Accession Number: BC096301\nGene Symbol: RSK2\nGene ID (NCBI): 6197\nRRID: AB_2879318\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P51812\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868944945321,"sku":"23762-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-23762-1-ap","provider":"Iright","version":"1.0","type":"link"}