{"product_id":"proteintech-23786-1-ap","title":"Proteintech, 23786-1-AP, PTPRU Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PTPRU (23786-1-AP) by Proteintech is a Polyclonal antibody targeting PTPRU in WB, IF\/ICC, ELISA applications with reactivity to human samples\n23786-1-AP targets PTPRU in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, MCF-7 cells,  U-251 cells\nPositive IF\/ICC detected in: U-251 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPTPRU (protein tyrosine phosphatase, receptor type, U) is also named as PCP-2,PTP-J, PTP pi, PTP-RO and R-PTP-psi. Protein tyrosine phosphatase plays a crucial role in the regulation of signal transduction during diverse cell functions, including cell activation, proliferation, differentiation, survival, and metabolic homeostasis. PTPases are classiﬁed into two groups, membrane-spanning receptor-type (R-PTPases) and cytosolictype. The human PTPRU cDNA clone encodes a polypeptide of 1,439 amino acids and the predicted molecular mass of the PTPRU protein is 162 kDa. It has reported that SCF induced tyrosine phosphorylation of the full-length PTPRU (190 kDa) and the proteolytic forms of PTPRU (100 and 80 kD). A non-tyrosine phosphorylated 73 kDa band was detected in addition to those of 190, 90, and 80 kDa. (PMID: 10397721).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag20667 Product name: Recombinant human PTPRU protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 19-146 aa of BC146655 Sequence: ETETPAAGCTFEEASDPAVPCEYSQAQYDDFQWEQVRIHPGTRAPADLPHGSYLMVNTSQHAPGQRAHVIFQSLSENDTHCVQFSYFLYSRDGHSPGTLGVYVRVNGGPLGSAVWNMTGSHGRQWHQA Predict reactive species\nFull Name: protein tyrosine phosphatase, receptor type, U\nCalculated Molecular Weight: 1446 aa, 162 kDa\nObserved Molecular Weight: 170 kDa\nGenBank Accession Number: BC146655\nGene Symbol: PTPRU\nGene ID (NCBI): 10076\nRRID: AB_3669416\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen Affinity purified\nUNIPROT ID: Q92729\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887777435817,"sku":"23786-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-23786-1-ap","provider":"Iright","version":"1.0","type":"link"}