{"product_id":"proteintech-23795-1-ap","title":"Proteintech, 23795-1-AP, PLXNB1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PLXNB1 (23795-1-AP) by Proteintech is a Polyclonal antibody targeting PLXNB1 in WB, IHC, ELISA applications with reactivity to human,  mouse samples\n23795-1-AP targets PLXNB1 in WB, IF, IHC, ELISA applications and shows reactivity with human,  mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue\nPositive IHC detected in: human kidney tissue, human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSemaphorins, originally identified as axon guidance molecules, have also been implicated in angiogenesis, immunoregulation, and cancer (PMID: 16584533). Plexins are main receptors for semaphorins and are thought to control many of the functional effects of semaphorins. PLXNB1 is one of the three plexin-B family members. It is a high-affinity receptor for semaphorin 4D (SEMA4D). Interaction of SEMA4D and PLXNB1 has important physiologic effects in the immune and nervous systems, and is also involved in tumor progression, especially in tumor angiogenesis (PMID: 20858260).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag20719 Product name: Recombinant human PLXNB1 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 20-369 aa of BC146793 Sequence: LQPLPPTAFTPNGTYLQHLARDPTSGTLYLGATNFLFQLSPGLQLEATVSTGPVLDSRDCLPPVMPDECPQAQPTNNPNQLLLVSPGALVVCGSVHQGVCEQRRLGQLEQLLLRPERPGDTQYVAANDPAVSTVGLVAQGLAGEPLLFVGRGYTSRGVGGGIPPITTRALWPPDPQAAFSYEETAKLAVGRLSEYSHHFVSAFARGASAYFLFLRRDLQAQSRAFRAYVSRVCLRDQHYYSYVELPLACEGGRYGLIQAAAVATSREVAHGEVLFAAFSSAAPPTVGRPPSAAAGASGASALCAFPLDEVDRLANRTRDACYTREGRAEDGTEVAYIEYDVNSDCAQLPV Predict reactive species\nFull Name: plexin B1\nCalculated Molecular Weight: 2135 aa, 232 kDa\nObserved Molecular Weight: 210 kDa\nGenBank Accession Number: BC146793\nGene Symbol: PLXNB1\nGene ID (NCBI): 5364\nRRID: AB_2879326\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen Affinity purified\nUNIPROT ID: O43157\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869007302825,"sku":"23795-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-23795-1-ap","provider":"Iright","version":"1.0","type":"link"}