{"product_id":"proteintech-23843-1-ap","title":"Proteintech, 23843-1-AP, ARCN1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ARCN1 (23843-1-AP) by Proteintech is a Polyclonal antibody targeting ARCN1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n23843-1-AP targets ARCN1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HepG2 cells,  A549 cells,  Jurkat cells,  mouse pancreas tissue,  rat pancreas tissue\nPositive IHC detected in: human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:16000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nArchain 1 (ARCN1), also known as delta-COP, is a subunit of the coat protein I (COPI) complex, which comprises one of the protein coats that mediate vesicle budding from the membrane. Protein sequences of ARCN1 are well conserved among eukaryotes and this protein may play a fundamental role in eukaryotic cell biology. It has similarities to heat shock proteins and clathrin-associated proteins, and may be involved in vesicle structure or trafficking. The gene of ARCN1 has been identified in chromosome band 11q23.3, and sequencing of cDNAs suggests that at least two forms of mRNA with alternative 5' ends are present. (PMID: 7782067; 20502676)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag20836 Product name: Recombinant human ARCN1 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 164-511 aa of BC093636 Sequence: KELQQARRDAERQGKKAPGFGGFGSSAVSGGSTAAMITETIIETDKPKVAPAPARPSGPSKALKLGAKGKEVDNFVDKLKSEGETIMSSSMGKRTSEATKMHAPPINMESVHMKIEEKITLTCGRDGGLQNMELHGMIMLRISDDKYGRIRLHVENEDKKGVQLQTHPNVDKKLFTAESLIGLKNPEKSFPVNSDVGVLKWRLQTTEESFIPLTINCWPSESGNGCDVNIEYELQEDNLELNDVVITIPLPSGVGAPVIGEIDGEYRHDSRRNTLEWCLPVIDAKNKSGSLEFSIAGQPNDFFPVQVSFVSKKNYCNIQVTKVTQVDGNSPVRFSTETTFLVDKYEIL Predict reactive species\nFull Name: archain 1\nCalculated Molecular Weight: 511 aa, 57 kDa\nObserved Molecular Weight: 57 kDa, 47 kDa\nGenBank Accession Number: BC093636\nGene Symbol: ARCN1\nGene ID (NCBI): 372\nRRID: AB_2879337\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P48444\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868992557225,"sku":"23843-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-23843-1-ap","provider":"Iright","version":"1.0","type":"link"}