{"product_id":"proteintech-23844-1-ap","title":"Proteintech, 23844-1-AP, SCF Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SCF (23844-1-AP) by Proteintech is a Polyclonal antibody targeting SCF in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n23844-1-AP targets SCF in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: K-562 cells\nPositive IHC detected in: mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells, HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nStem cell factor (SCF) is also named as mast cell growth factor (MGF), Kit ligand (Kitl), c-Kit ligand,  steel factor and Kitlg. SCF is a pleiotropic cytokine (also as a dimeric molecule) that mediates regulatory effects on  inflammation, tissue remodeling,  and fibrosis through binding to and activating its receptor tyrosine kinase c-Kit (PMID: 1698553, PMID: 8630386, PMID:  23073628). SCF is the ligand of c-Kit,  a member of the RTKs family. Molecular activity of RTKs is a primary stimulus of cell motility,  and expression of the SCF\/c-Kit axis is associated with cell migration (PMID:  28629522). SCF is a cytokine that synergizes the effects of Epo during erythropoiesis. Stem cell factor plays a  well-described role in regulating the survival, proliferation, migration,  and differentiation of hematopoietic progenitors, melanocytes, and germ cells (PMID:  36688460). More recent studies have demonstrated SCF expression in dermal and intestinal epithelial cells,  and increased SCF expression has been reported in the inflamed mucosa of individuals with IBD and colonitis (PMID:  18200049, PMID: 30157426).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag20837 Product name: Recombinant human SCF protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-273 aa of BC074725 Sequence: MKKTQTWILTCIYLQLLLFNPLVKTEGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKAKNPPGDSSLHWAAMALPALFSLIIGFAFGALYWKKRQPSLTRAVENIQINEEDNEISMLQEKEREFQEV Predict reactive species\nFull Name: KIT ligand\nCalculated Molecular Weight: 273 aa, 31 kDa\nObserved Molecular Weight: 31 kDa\nGenBank Accession Number: BC074725\nGene Symbol: SCF\nGene ID (NCBI): 4254\nRRID: AB_3669419\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen Affinity purified\nUNIPROT ID: P21583\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887793393833,"sku":"23844-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-23844-1-ap","provider":"Iright","version":"1.0","type":"link"}