{"product_id":"proteintech-23854-1-ap","title":"Proteintech, 23854-1-AP, BCHE Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe BCHE (23854-1-AP) by Proteintech is a Polyclonal antibody targeting BCHE in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n23854-1-AP targets BCHE in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells,  HEK-293 cells\nPositive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nBCHE(butyrylcholinesterase) is an enzyme expressed in most human tissues. It may have a greater role in cholinergic transmission than previously surmised, making BChE inhibition an important therapeutic goal in Alzheimer's disease(PMID:11848688). BCHE is also named as CHE1 and belongs to the type-B carboxylesterase\/lipase family. This is a glycoprotein with the molecular weight from 68 kDa to 90 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, goat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag20888 Product name: Recombinant human BCHE protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 539-602 aa of BC008396 Sequence: MTKLRAQQCRFWTSFFPKVLEMTGNIDEAEWEWKAGFHRWNNYMMDWKNQFNDYTSKKESCVGL Predict reactive species\nFull Name: butyrylcholinesterase\nCalculated Molecular Weight: 602 aa, 68 kDa\nObserved Molecular Weight: 85-90 kDa\nGenBank Accession Number: BC008396\nGene Symbol: BCHE\nGene ID (NCBI): 590\nRRID: AB_2879341\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen Affinity purified\nUNIPROT ID: P06276\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869394620585,"sku":"23854-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-23854-1-ap","provider":"Iright","version":"1.0","type":"link"}