{"product_id":"proteintech-23887-1-ap","title":"Proteintech, 23887-1-AP, ODF2L Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ODF2L (23887-1-AP) by Proteintech is a Polyclonal antibody targeting ODF2L in WB, ELISA applications with reactivity to human,  mouse,  rat samples\n23887-1-AP targets ODF2L in WB, IF, ELISA applications and shows reactivity with human,  mouse,  rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, mouse kidney tissue,  rat kidney tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nODF2L, also named as KIAA1229, has many isoforms with MW 60-80 kDa. The function of ODF2L (Outer dense fiber protein 2-like) remains largely unknown.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag20897 Product name: Recombinant human ODF2L protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-38 aa of BC009779 Sequence: SLETKIAKWNLQSRMNKNEAIVMKEASRQKTVALKKGI Predict reactive species\nFull Name: outer dense fiber of sperm tails 2-like\nCalculated Molecular Weight: 513 aa, 60 kDa\nObserved Molecular Weight: 60-74 kDa\nGenBank Accession Number: BC009779\nGene Symbol: ODF2L\nGene ID (NCBI): 57489\nRRID: AB_2879351\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen Affinity purified\nUNIPROT ID: Q9ULJ1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869568880809,"sku":"23887-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-23887-1-ap","provider":"Iright","version":"1.0","type":"link"}