{"product_id":"proteintech-23894-1-ap","title":"Proteintech, 23894-1-AP, ATAD2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ATAD2 (23894-1-AP) by Proteintech is a Polyclonal antibody targeting ATAD2 in WB, IF\/ICC, IP, ELISA applications with reactivity to human samples\n23894-1-AP targets ATAD2 in WB, IF\/ICC, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells\nPositive IP detected in: HeLa cells\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nATAD2 is one of them encoding a conserved factor harbouring an AAA type ATPase domain and a bromodomain. ATAD2 controls chromatin dynamics, genome transcriptional activities and apoptotic cell response. This protein has 2 isoforms produced by alternative splicing.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag20947 Product name: Recombinant human ATAD2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-150 aa of BC113656 Sequence: MVVLRSSLELHNHSAASATGSLDLSSDFLSLEHIGRRRLRSAGAAQKKPAATTAKAGDGSSVKEVETYHRTRALRSLRKDAQNSSDSSFEKNVEITEQLANGRHFTRQLARQQADKKKEEHREDKVIPVTRSLRARNIVQSTEHLHEDNG Predict reactive species\nFull Name: ATPase family, AAA domain containing 2\nCalculated Molecular Weight: 1390 aa, 159 kDa\nObserved Molecular Weight: 159 kDa\nGenBank Accession Number: BC113656\nGene Symbol: ATAD2\nGene ID (NCBI): 29028\nRRID: AB_2879352\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q6PL18\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868993114281,"sku":"23894-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-23894-1-ap","provider":"Iright","version":"1.0","type":"link"}