{"product_id":"proteintech-23909-1-ap","title":"Proteintech, 23909-1-AP, AFAP1L1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe AFAP1L1 (23909-1-AP) by Proteintech is a Polyclonal antibody targeting AFAP1L1 in WB, ELISA applications with reactivity to human,   monkey samples\n23909-1-AP targets AFAP1L1 in WB, ELISA applications and shows reactivity with human,   monkey samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: COS-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nActin Filament-Associated Protein of 110 kDa (AFAP-110\/AFAP1) is an adaptor protein with multiple protein binding motifs that is known to function as both an actin binding protein and a cSrc activating protein. A homology search of AFAP1 recently identified AFAP1L1 which has a similar sequence, domain structure and cellular localization. AFAP1L1 is highly expressed in human breast, colon and brain tissue. AFAP1L1 interacts with cortactin and involves the invadosomes formation. AFAP1L1 as a prognostic marker has a role in the progression of spindle cell sarcomas.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, monkey\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag21006 Product name: Recombinant human AFAP1L1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-117 aa of BC125093 Sequence: MDRGQVLEQLLPELTGLLSLLDHEYLSDTTLEKKMAVASILQSLQPLPAKEVSYLYVNTADLHSGPSFVESLFEEFDCDLSDLRDMPEDDGEPSKGASPELAKSPRLRNAADLPPPL Predict reactive species\nFull Name: actin filament associated protein 1-like 1\nCalculated Molecular Weight: 768 aa, 86 kDa\nObserved Molecular Weight: 75-86 kDa\nGenBank Accession Number: BC125093\nGene Symbol: AFAP1L1\nGene ID (NCBI): 134265\nRRID: AB_2879358\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen Affinity purified\nUNIPROT ID: Q8TED9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869804482729,"sku":"23909-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-23909-1-ap","provider":"Iright","version":"1.0","type":"link"}