{"product_id":"proteintech-23910-1-ap","title":"Proteintech, 23910-1-AP, AKR1D1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe AKR1D1 (23910-1-AP) by Proteintech is a Polyclonal antibody targeting AKR1D1 in WB, ELISA applications with reactivity to human,  mouse,   rat samples\n23910-1-AP targets AKR1D1 in WB, ELISA applications and shows reactivity with human,  mouse,   rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse liver tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAKR1D1 (steroid 5β-reductase) reduces all Δ 4-3-ketosteroids to form 5β-dihydrosteroids, a first step in the clearance of steroid hormones and an essential step in the synthesis of all bile acids. It is also named as SRD5B1 and belongs to the aldo\/keto reductase family. This protein has 3 isoforms produced by alternative splicing.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag21009 Product name: Recombinant human AKR1D1 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 209-326 aa of BC130627 Sequence: CQQHDIVITAYSPLGTSRNPIWVNVSSPPLLKDALLNSLGKRYNKTAAQIVLRFNIQRGVVVIPKSFNLERIKENFQIFDFSLTEEEMKDIEALNKNVRFVELLMWRDHPEYPFHDEY Predict reactive species\nFull Name: aldo-keto reductase family 1, member D1 (delta 4-3-ketosteroid-5-beta-reductase)\nCalculated Molecular Weight: 326 aa, 37 kDa\nObserved Molecular Weight: 33 kDa\nGenBank Accession Number: BC130627\nGene Symbol: AKR1D1\nGene ID (NCBI): 6718\nRRID: AB_2879359\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen Affinity purified\nUNIPROT ID: P51857\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869806612649,"sku":"23910-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-23910-1-ap","provider":"Iright","version":"1.0","type":"link"}