{"product_id":"proteintech-23923-1-ap","title":"Proteintech, 23923-1-AP, C14orf126 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe C14orf126 (23923-1-AP) by Proteintech is a Polyclonal antibody targeting C14orf126 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n23923-1-AP targets C14orf126 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, mouse cerebellum tissue,  HepG2 cells,  mouse lung tissue\nPositive IHC detected in: mouse lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A549 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nC14orf126, also named D-aminoacyl-tRNA deacylase 2 (DTD2), can deacylate L-Ala due to a relaxed specificity for substrate chirality caused by the trans conformation of the Gly-Pro motif in the active site. Plants are unique in possessing two distinct chiral proofreading systems, D-aminoacyl-tRNA deacylase1 (DTD1) and DTD2, of bacterial and archaeal origins, respectively.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag21053 Product name: Recombinant human C14orf126 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-168 aa of BC010618 Sequence: MAEGSRIPQARALLQQCLHARLQIRPADGDVAAQWVEVQRGLVIYVCFFKGADKELLPKMVNTLLNVKLSETENGKHVSILDLPGNILIIPQATLGGRLKGRNMQYHSNSGKEEGFELYSQFVTLCEKEVAANSKCAEARVVVEHGTYGNRQVLKLDTNGPFTHLIEF Predict reactive species\nFull Name: chromosome 14 open reading frame 126\nCalculated Molecular Weight: 168 aa, 19 kDa\nObserved Molecular Weight: 19 kDa\nGenBank Accession Number: BC010618\nGene Symbol: C14orf126\nGene ID (NCBI): 112487\nRRID: AB_3669426\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen Affinity purified\nUNIPROT ID: Q96FN9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885421678761,"sku":"23923-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-23923-1-ap","provider":"Iright","version":"1.0","type":"link"}