{"product_id":"proteintech-23933-1-ap","title":"Proteintech, 23933-1-AP, LY6H Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe LY6H (23933-1-AP) by Proteintech is a Polyclonal antibody targeting LY6H in WB, IHC, ELISA applications with reactivity to human, mouse samples\n23933-1-AP targets LY6H in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Raji cells\nPositive IHC detected in: human testis tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nLY6H is highly expressed in particular subdivisions of human brain and also in MOLT-3 and -4 acute lymphoblastic leukemia cells. It has some isoforms with MW 14-16 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag20762 Product name: Recombinant human LY6H protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 20-140 aa of BC028894 Sequence: SAPAHGLWCQDCTLTTNSSHCTPKQCQPSDTVCASVRITDPSSSRKDHSVNKMCASSCDFVKRHFFSDYLMGFINSGILKVDVDCCEKDLCNGAAGAGHSPWALAGGLLLSLGPALLWAGP Predict reactive species\nFull Name: lymphocyte antigen 6 complex, locus H\nCalculated Molecular Weight: 15 kDa\nObserved Molecular Weight: 16 kDa\nGenBank Accession Number: BC028894\nGene Symbol: LY6H\nGene ID (NCBI): 4062\nRRID: AB_2879366\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen Affinity purified\nUNIPROT ID: O94772\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887709769897,"sku":"23933-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-23933-1-ap","provider":"Iright","version":"1.0","type":"link"}