{"product_id":"proteintech-23995-1-ap","title":"Proteintech, 23995-1-AP, FNDC5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FNDC5 (23995-1-AP) by Proteintech is a Polyclonal antibody targeting FNDC5 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n23995-1-AP targets FNDC5 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse liver tissue, mouse stomach tissue,  mouse skeletal muscle tissue,  rat liver tissue\nPositive IHC detected in: mouse skeletal muscle tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nfibronectin type III domain containing 5(FNDC5)encodes 23kDa protein, which is a membrane  protein that is cleaved and secreted as a newly identified hormone, irisin. The exercise induces muscle FNDC5 expression. Exercise-induced FNDC5 gene expression in muscles was accompanied by a parallel increase in the concentration of circulating irisin, which in turn activates adipocyte thermogenic programs, leading to mitochondrial heat production and energy expenditure.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag21195 Product name: Recombinant human FNDC5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 14-76 aa of BC062297 Sequence: SCALWDLEEDTEYIVHVQAISIQGQSPASEPVLFKTPREAEKMASKNKDEVTMKEMGRNQQLR Predict reactive species\nFull Name: fibronectin type III domain containing 5\nCalculated Molecular Weight: 212 aa, 24 kDa\nObserved Molecular Weight: 25-30 kDa\nGenBank Accession Number: BC062297\nGene Symbol: FNDC5\nGene ID (NCBI): 252995\nRRID: AB_2879394\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8NAU1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868851490985,"sku":"23995-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-23995-1-ap","provider":"Iright","version":"1.0","type":"link"}