{"product_id":"proteintech-24002-1-ap","title":"Proteintech, 24002-1-AP, CEP89, CCDC123 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CEP89, CCDC123 (24002-1-AP) by Proteintech is a Polyclonal antibody targeting CEP89, CCDC123 in WB, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n24002-1-AP targets CEP89, CCDC123 in WB, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: SH-SY5Y cells, Neuro-2a cells\nPositive IF\/ICC detected in: U-251 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCCDC123(as known as CEP123), also named as CEP89, is a new player in the process of primary ciliogenesis and it also plays a role in mitochondrial metabolism where it may modulate complex IV activity. It has been shown that CEP123 is localized to the distal appendages of the mother centriolecep and the localization of CEP123 is cell cycle-dependent with its levels decreasing during mitosis. CEP123 depletion can cause defects in ciliary vesicle formationcep and prevent the formation of a ciliary vesicle at the distal end of the mother centriole. It is possible that CEP123 is involved in regulating the recruitment of membranes to the centrosome through its interaction with Cep290(PMID:23575228, 23789104, 23348840). 24002-1-AP antibody recognizes all of CEP123 isoforms.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag21206 Product name: Recombinant human CCDC123 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 248-343 aa of BC136328 Sequence: MDLNNMNQSLTLELNTMKQAMKELQLKLKGMEKEKRKLKEAEKASSQEVAAPELLYLRKQAQELVDENDGLKMTVHRLNVELSRYQTKFRHLSKEE Predict reactive species\nFull Name: coiled-coil domain containing 123\nCalculated Molecular Weight: 783 aa, 90 kDa\nObserved Molecular Weight: 85-100 kDa, 40 kDa\nGenBank Accession Number: BC136328\nGene Symbol: CEP89\nGene ID (NCBI): 84902\nRRID: AB_2879400\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96ST8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868995375273,"sku":"24002-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-24002-1-ap","provider":"Iright","version":"1.0","type":"link"}