{"product_id":"proteintech-24024-1-ap","title":"Proteintech, 24024-1-AP, B4GALNT2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe B4GALNT2 (24024-1-AP) by Proteintech is a Polyclonal antibody targeting B4GALNT2 in WB, IHC, ELISA applications with reactivity to human samples\n24024-1-AP targets B4GALNT2 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells,  COLO 320 cells\nPositive IHC detected in: human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:600-1:2400\n\u003cb\u003eBackground Information\u003c\/b\u003e\nB4GALNT2, also named as GALGT2, catalyzes the last step in the biosynthesis of the human Sd(a) antigen, which is found on more than 90% of Caucasian red blood cells. It also catalyzes the last step in the biosynthesis of the Cad antigen, which is related both serologically and biochemically to the Sd(a) antigen. B4GALNT2 transfers a beta-1,4-linked GalNAc to the galactose residue of an alpha-2,3-sialylated chain. This antibody detects the 55-65 kDa B4GALNT2 protein.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag21166 Product name: Recombinant human B4GALNT2 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 497-566 aa of BC113677 Sequence: HSEFFIDGLGTLLVGSCPEVIIGHQSRSPVVDSELAALEKTYNTYRSNTLTRVQFKLALHYFKNHLQCAA Predict reactive species\nFull Name: beta-1,4-N-acetyl-galactosaminyl transferase 2\nCalculated Molecular Weight: 566 aa, 63 kDa\nObserved Molecular Weight: 65 kDa\nGenBank Accession Number: BC113677\nGene Symbol: B4GALNT2\nGene ID (NCBI): 124872\nRRID: AB_2879405\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen Affinity purified\nUNIPROT ID: Q8NHY0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885170610345,"sku":"24024-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-24024-1-ap","provider":"Iright","version":"1.0","type":"link"}