{"product_id":"proteintech-24031-1-ap","title":"Proteintech, 24031-1-AP, ASB5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ASB5 (24031-1-AP) by Proteintech is a Polyclonal antibody targeting ASB5 in WB, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n24031-1-AP targets ASB5 in WB, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse skeletal muscle tissue, mouse heart tissue,  rat skeletal muscle tissue\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nASB5, also named as Ankyrin repeat and SOCS box-containing 5, is a 329 amino acid protein, which contains a conserved one C-terminal SOCS box motif.  Asb5 was significantly upregulated in growing collateral arteries on mRNA and protein level. It has been shown that asb5 is a protein implicated in the initiation of arteriogenesis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag21230 Product name: Recombinant human ASB5 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 245-329 aa of BC065710 Sequence: STEIVNLLLEFGADINAKNTELLRPIDVATSSSMVERILLQHEATPSSLYQLCRLCIRSYIGKPRLHLIPQLQLPTLLKNFLQYR Predict reactive species\nFull Name: ankyrin repeat and SOCS box-containing 5\nCalculated Molecular Weight: 329 aa, 36 kDa\nObserved Molecular Weight: 36-40 kDa\nGenBank Accession Number: BC065710\nGene Symbol: ASB5\nGene ID (NCBI): 140458\nRRID: AB_2879410\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8WWX0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885072076969,"sku":"24031-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-24031-1-ap","provider":"Iright","version":"1.0","type":"link"}