{"product_id":"proteintech-24036-1-ap","title":"Proteintech, 24036-1-AP, PCNA Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PCNA (24036-1-AP) by Proteintech is a Polyclonal antibody targeting PCNA in WB, IHC, IF-P, IP, ELISA applications with reactivity to human, mouse, rat samples\n24036-1-AP targets PCNA in WB, IHC, IF-P, IP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, mouse testis tissue,  Raji cells,  HEK-293 cells,  NIH\/3T3 cells,  MCF-7 cells,  rat liver tissue,  HepG2 cells,  Jurkat cells\nPositive IP detected in: HEK-293 cells\nPositive IHC detected in: human breast cancer tissue, human gliomas tissue,  human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human breast cancer tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:14000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe proliferating cell nuclear antigen (PCNA), a protein synthesized in early G1 and S phases of the cell cycle, functions in cell cycle progression, DNA replication and DNA repair. In early S phase, PCNA exhibits granular distribution and is absent from the nucleoli; however, in late S phase, it relocates to the nucleoli. PCNA exists in two basic forms: one involved in ongoing DNA replication, which localizes specifically to the nucleus, and a second, soluble form, not implicated in constant synthesis. Interestingly, the latter form degrades in the presence of organic solvents, rendering it undetectable by histological methods in tissues using organic fixatives, and thus also providing a method of visualizing only the synthesizing form.This antibody specifically react with the 36kd human PCNA protein.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, rabbit, zebrafish\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag7416 Product name: Recombinant human PCNA protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 8-256 aa of BC000491 Sequence: QGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIE Predict reactive species\nFull Name: proliferating cell nuclear antigen\nCalculated Molecular Weight: 29 kDa\/31 kDa\nObserved Molecular Weight: 36-38 kDa\nGenBank Accession Number: BC000491\nGene Symbol: PCNA\nGene ID (NCBI): 5111\nRRID: AB_2879414\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P12004\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868852834473,"sku":"24036-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-24036-1-ap","provider":"Iright","version":"1.0","type":"link"}