{"product_id":"proteintech-24066-1-ap","title":"Proteintech, 24066-1-AP, SLC36A4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC36A4 (24066-1-AP) by Proteintech is a Polyclonal antibody targeting SLC36A4 in WB, ELISA applications with reactivity to human samples\n24066-1-AP targets SLC36A4 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells,  HEK-293 cells,  PC-3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSLC36A4 (also known as proton-coupled amino-acid transporter 4, PAT4), is a member of the solute carrier (SLC) 36 family which functions as transporter for amino acids and derivatives. SLC36A4 is widely distributed at the mRNA level in normal tissues and many cancer cell lines. It modulates the mTORC1 signaling and is essential for the proliferation of cancer cells. In addition, small GTPase Rab12 controls the degradation of SLC36A4, which indirectly modulates mTORC1 activity and autophagy. This antibody can recognize the endogenous SLC36A4 protein in multiple cell lines.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag21142 Product name: Recombinant human SLC36A4 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-207 aa of BC047374 Sequence: MEAAATPAAAGAARREELDMDVMRPLINEQNFDGTSDEEHEQELLPVQKHYQLDDQEGISFVQTLMHLLKGNIGTGLLGLPLAIKNAGIVLGPISLVFIGIISVHCMHILVRCSHFLCLRFKKSTLGYSDTVSFAMEVSPWSCLQKQAAWGRSVVDFFLVITQLGFCSVYIVFLAENVKQVHEGFLESKVFISNSTNSSNPCERRSV Predict reactive species\nFull Name: solute carrier family 36 (proton\/amino acid symporter), member 4\nCalculated Molecular Weight: 504 aa, 56 kDa\nObserved Molecular Weight: 41-66 kDa\nGenBank Accession Number: BC047374\nGene Symbol: SLC36A4\nGene ID (NCBI): 120103\nRRID: AB_2879424\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen Affinity purified\nUNIPROT ID: Q6YBV0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887806337193,"sku":"24066-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-24066-1-ap","provider":"Iright","version":"1.0","type":"link"}