{"product_id":"proteintech-24067-1-ap","title":"Proteintech, 24067-1-AP, CEP120 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CEP120 (24067-1-AP) by Proteintech is a Polyclonal antibody targeting CEP120 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n24067-1-AP targets CEP120 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, mouse lung tissue\nPositive IHC detected in: human pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCEP120 encodes a protein that functions in the microtubule-dependent coupling of the nucleus and the centrosome. It is involved in regulating centrosome-mediated interkinetic nuclear migration of neural progenitors (PMID: 27185865, 23857771). CEP120, SPICE1, and CPAP are required for centriole elongation and for the recruitment of distal microtubule-capping proteins and CEP135 to procentrioles (PMID: 23810536). Cep120 and Taccs are required for the neural progenitor pool during mouse neocortical development (PMID: 17920017).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag21165 Product name: Recombinant human CEP120 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 85-346 aa of BC040527 Sequence: VTSAKETIGYIVLDLRTAQETKQAPKWYQLLSNKYTKFKSEIQISIALETDTKPPVDSFKAKGAPPRDGKVPAILAGLDPRDIVAVLNEEGGYHQIGPAEYCTDSFIMSVTIAFATQLEQLIPCTMKLPERQPEFFFYYSLLGNDVTNEPFNDLINPNFEPERASVRIRSSVEILRVYLALQSKLQIHLCCGDQSLGSTEIPLTGLLKKGSTEINQHPVTVEGAFTLDPPNRAKQKLAPIPVELAPTVGVSVALQREGIDSQ Predict reactive species\nFull Name: centrosomal protein 120kDa\nCalculated Molecular Weight: 986 aa, 113 kDa\nObserved Molecular Weight: 120-130 kDa\nGenBank Accession Number: BC040527\nGene Symbol: CEP120\nGene ID (NCBI): 153241\nRRID: AB_3085721\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8N960\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886483460265,"sku":"24067-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-24067-1-ap","provider":"Iright","version":"1.0","type":"link"}