{"product_id":"proteintech-24112-1-ap","title":"Proteintech, 24112-1-AP, ZMYM2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ZMYM2 (24112-1-AP) by Proteintech is a Polyclonal antibody targeting ZMYM2 in WB, IP, ELISA applications with reactivity to human samples\n24112-1-AP targets ZMYM2 in WB, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Daudi cells, NCCIT cells,  Raji cells\nPositive IP detected in: Raji cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag21370 Product name: Recombinant human ZMYM2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 166-252 aa of BC036372 Sequence: NAGMGNSGITTEPDSEIQIANVTTLETGVSSVNDGQLENTDGRDMNLMITHVTSLQNTNLGDVSNGLQSSNFGVNIQTYTPSLTSQT Predict reactive species\nFull Name: zinc finger, MYM-type 2\nCalculated Molecular Weight: 1377 aa, 155 kDa\nObserved Molecular Weight: 155-180 kDa\nGenBank Accession Number: BC036372\nGene Symbol: ZMYM2\nGene ID (NCBI): 7750\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen Affinity purified\nUNIPROT ID: Q9UBW7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869795307689,"sku":"24112-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-24112-1-ap","provider":"Iright","version":"1.0","type":"link"}