{"product_id":"proteintech-24142-1-ap","title":"Proteintech, 24142-1-AP, PSMC3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PSMC3 (24142-1-AP) by Proteintech is a Polyclonal antibody targeting PSMC3 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human samples\n24142-1-AP targets PSMC3 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, A431 cells,  HeLa cells,  HepG2 cells,  Jurkat cells,  MCF-7 cells,  T-47D cells\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human ovary tumor tissue,  human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPSMC3(26S protease regulatory subunit 6A) is also named as TBP1, Proteasome 26S subunit ATPase 3 and belongs to the AAA ATPase family. The 26S protease is involved in the ATP-dependent degradation of ubiquitinated proteins. It is a multifunctional protein, component of the regulatory subunit of the proteasome, involved in different cellular processes.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag21408 Product name: Recombinant human PSMC3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-200 aa of BC008713 Sequence: MNLLPNIESPVTRQEKMATVWDEAEQDGIGEEVLKMSTEEIIQRTRLLDSEIKIMKSEVLRVTHELQAMKDKIKENSEKIKVNKTLPYLVSNVIELLDVDPNDQEEDGANIDLDSQRKGKCAVIKTSTRQTYFLPVIGLVDAEKLKPGDLVGVNKDSYLILETLPTEYDSRVKAMEVDERPTEQYSDIGGLDKQIQELVE Predict reactive species\nFull Name: proteasome (prosome, macropain) 26S subunit, ATPase, 3\nCalculated Molecular Weight: 49 kDa\nObserved Molecular Weight: 49 kDa\nGenBank Accession Number: BC008713\nGene Symbol: PSMC3\nGene ID (NCBI): 5702\nRRID: AB_2879440\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen Affinity purified\nUNIPROT ID: P17980\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869425225897,"sku":"24142-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-24142-1-ap","provider":"Iright","version":"1.0","type":"link"}