{"product_id":"proteintech-24169-1-ap","title":"Proteintech, 24169-1-AP, ATF6 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ATF6 (24169-1-AP) by Proteintech is a Polyclonal antibody targeting ATF6 in WB, IHC, IF\/ICC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples\n24169-1-AP targets ATF6 in WB, IHC, IF\/ICC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HEK-293 cells,  HeLa cells,  MCF-7 cells,  mouse liver tissue,  rat liver,  rat liver tissue\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human cervical cancer tissue, human breast hyperplasia tissue,  human pancreas cancer tissue,  human pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nActivating transcription factor 6 (ATF6) is a transcription factor that acts during endoplasmic reticulum stress by activating unfolded protein response target genes. Binds DNA on the 5'-CCAC[GA]-3'half of the ER stress response element (ERSE) (5'-CCAAT-N(9)-CCAC[GA]-3') and of ERSE II (5'-ATTGG-N-CCACG-3'). Binding to ERSE requires binding of NF-Y to ERSE. Could also be involved in activation of transcription by the serum response factor.During unfolded protein response an approximative 50 kDa fragment containing the cytoplasmic transcription factor domain is released by proteolysis. The cleavage seems to be performed sequentially by site-1 and site-2 proteases. The fully glycosylated form of ATF6, a 670 amino acid protein, exhibits an electrophoretic mobility of ~90 kDa in denaturing SDS-gels, in part because of the glycosylated modifications.  ATF6 has 3 consensus sites for N-linked glycosylation and exists constitutively as a glycosylated protein.  Differentially glycosylated ATF6 forms may result from mutations or experimental treatment (PMID:15804611) (PMID:14699159). The antibody recognizes cleaved and fully glycosylated forms of ATF6.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, pig, monkey, chicken, bovine\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag21456 Product name: Recombinant human ATF6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-194 aa of BC014969 Sequence: MGEPAGVAGTMESPFSPGLFHRLDEDWDSALFAELGYFTDTDELQLEAANETYENNFDNLDFDLDLVPWESDIWDINNQICTVKDIKAEPQPLSPASSSYSVSSPRSVDSYSSTQHVPEELDLSSSSQMSPLSLYGENSNSLSSAEPLKEDKPVTGPRNKTENGLTPKKKIQVNSKPSIQPKPLLLPAAPKTQT Predict reactive species\nFull Name: activating transcription factor 6\nCalculated Molecular Weight: 75 kDa\nObserved Molecular Weight: 60-70 kDa, 90-100 kDa\nGenBank Accession Number: BC014969\nGene Symbol: ATF6\nGene ID (NCBI): 22926\nRRID: AB_2876891\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P18850\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868821475497,"sku":"24169-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-24169-1-ap","provider":"Iright","version":"1.0","type":"link"}