{"product_id":"proteintech-24200-1-ap","title":"Proteintech, 24200-1-AP, ROMO1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ROMO1 (24200-1-AP) by Proteintech is a Polyclonal antibody targeting ROMO1 in WB, IHC, ELISA applications with reactivity to human samples\n24200-1-AP targets ROMO1 in WB, IHC, IF, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells\nPositive IHC detected in: human lung cancer tissue, human gliomas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, rat, pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag20368 Product name: Recombinant human ROMO1 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-79 aa of BC008488 Sequence: MPVAVGPYGQSQPSCFDRVKMGFVMGCAVGMAAGALFGTFSCLRIGMRGRELMGGIGKTMMQSGGTFGTFMAIGMGIRC Predict reactive species\nFull Name: reactive oxygen species modulator 1\nCalculated Molecular Weight: 79 aa, 8 kDa\nObserved Molecular Weight: 6-10 kDa\nGenBank Accession Number: BC008488\nGene Symbol: ROMO1\nGene ID (NCBI): 140823\nRRID: AB_2879453\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P60602\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868973224105,"sku":"24200-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-24200-1-ap","provider":"Iright","version":"1.0","type":"link"}