{"product_id":"proteintech-24201-1-ap","title":"Proteintech, 24201-1-AP, WNT6 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe WNT6 (24201-1-AP) by Proteintech is a Polyclonal antibody targeting WNT6 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n24201-1-AP targets WNT6 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: SGC-7901 cells\nPositive IHC detected in: mouse brain tissue, human small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nWNT6 belongs to the Wnt family. It is ligand for members of the frizzled family of seven transmembrane receptors. WNT6 is likely to signal over only few cell diameters. WNT6 may be together with CAV1 to promote chemoresistance of gastric cancer cells to DNA-damaging anthracycline drugs through the activation of the canonical Wnt receptor signaling pathway. And WNT6 is mainly expressed in brain, endometrium epithelium, gastric cancer cell lines and gastric cancer tissues (PMID: 22370641).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, chicken\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag20889 Product name: Recombinant human WNT6 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 36-365 aa of BC004329 Sequence: DPTSICRKARRLAGRQAELCQAEPEVVAELARGARLGVRECQFQFRFRRWNCSSHSKAFGRILQQDIRETAFVFAITAAGASHAVTQACSMGELLQCGCQAPRGRAPPRPSGLPGTPGPPGPAGSPEGSAAWEWGGCGDDVDFGDEKSRLFMDARHKRGRGDIRALVQLHNNEAGRLAVRSHTRTECKCHGLSGSCALRTCWQKLPPFREVGARLLERFHGASRVMGTNDGKALLPAVRTLKPPGRADLLYAADSPDFCAPNRRTGSPGTRGRACNSSAPDLSGCDLLCCGRGHRQESVQLEENCLCRFHWCCVVQCHRCRVRKELSLCL Predict reactive species\nFull Name: wingless-type MMTV integration site family, member 6\nCalculated Molecular Weight: 39 kDa\nObserved Molecular Weight: 42 kDa\nGenBank Accession Number: BC004329\nGene Symbol: WNT6\nGene ID (NCBI): 7475\nRRID: AB_2879454\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y6F9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868946649257,"sku":"24201-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-24201-1-ap","provider":"Iright","version":"1.0","type":"link"}