{"product_id":"proteintech-24298-1-ap","title":"Proteintech, 24298-1-AP, MFSD8 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MFSD8 (24298-1-AP) by Proteintech is a Polyclonal antibody targeting MFSD8 in WB, IHC, ELISA applications with reactivity to human,  mouse samples\n24298-1-AP targets MFSD8 in WB, IHC, IF, ELISA applications and shows reactivity with human,  mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse liver tissue\nPositive IHC detected in: human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18086 Product name: Recombinant human MFSD8 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 351-421 aa of BC029503 Sequence: FFILLPWGNQFPKIQWEDLHNNSIPNTTFGEIIIGLWKSPMEDDNERPTGCSIEQAWCLYTPVIHLAQFLT Predict reactive species\nFull Name: major facilitator superfamily domain containing 8\nCalculated Molecular Weight: 518 aa, 58 kDa\nObserved Molecular Weight: 55-60 kDa\nGenBank Accession Number: BC029503\nGene Symbol: MFSD8\nGene ID (NCBI): 256471\nRRID: AB_2879481\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8NHS3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869559410857,"sku":"24298-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-24298-1-ap","provider":"Iright","version":"1.0","type":"link"}