{"product_id":"proteintech-24299-1-ap","title":"Proteintech, 24299-1-AP, GRAMD4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GRAMD4 (24299-1-AP) by Proteintech is a Polyclonal antibody targeting GRAMD4 in WB, ELISA applications with reactivity to human samples\n24299-1-AP targets GRAMD4 in WB, IP, IF, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: PC-3 cells, Jurkat cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGRAMD4 also termed as Death inducing protein is a 578 amino-acid protein, which contains 1 GRAM domain. GRAMD4 as a multi-pass membrane protein localizes in the Mitochondrion membrane. Overexpression of GRAMD4 results in a strong apoptotic response involving caspase-3 activation and cleavage of poly(ADP-ribose)-polymerase. GRAMD4 is expressed in lung and in primary lung squamous cell carcinoma (LSCC) and shows up-regulation in mitochondria by E2F-1 after addition of 4-hydroxytamoxifen. This evidence suggests that GRAMD4 may be a potential target for cancer therapies. Full-length GRAMD4 expresses a protein of 66 kDa, whereas the 255 bp-deletion mutant expresses a protein of 56 kDa (PMID: 21127500).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag19140 Product name: Recombinant human GRAMD4 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 479-578 aa of BC129837 Sequence: PTDYIRNGVLYVTENYLCFESSKSGSSKRNKVIKLVDITDIQKYKVLSVLPGSGMGIAVSTPSTQKPLVFGAMVHRDEAFETILSQYIKITSAAASGGDS Predict reactive species\nFull Name: GRAM domain containing 4\nCalculated Molecular Weight: 578 aa, 66 kDa\nObserved Molecular Weight: 56, 60 kDa\nGenBank Accession Number: BC129837\nGene Symbol: GRAMD4\nGene ID (NCBI): 23151\nRRID: AB_2879482\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q6IC98\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869689729193,"sku":"24299-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-24299-1-ap","provider":"Iright","version":"1.0","type":"link"}