{"product_id":"proteintech-24304-1-ap","title":"Proteintech, 24304-1-AP, cIAP2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe cIAP2 (24304-1-AP) by Proteintech is a Polyclonal antibody targeting cIAP2 in WB, IHC, IP, ELISA applications with reactivity to human, mouse samples\n24304-1-AP targets cIAP2 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Daudi cells, HeLa cells,  RAW 264.7 cells,  U-937 cells,  Raji cells\nPositive IP detected in: Daudi cells\nPositive IHC detected in: human tonsillitis tissue, human lung cancer tissue,  human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:12000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\ncIAP2 also known as BIRC3, is a member of the Inhibitor of Apoptosis Protein (IAP) family. cIAP2 is induced by inflammatory stimuli and plays a critical role in regulating adaptive and innate immune responses, cell death, and the production of inflammatory mediators. Its dysregulation is associated with various diseases, including cancer and neuroinflammatory conditions. Understanding the mechanisms by which cIAP2 functions and interacts with other cellular components is essential for developing targeted therapies.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag20143 Product name: Recombinant human BIRC3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 78-169 aa of BC027485 Sequence: RGDSPTEKHKKLYPSCRFVQSLNSVNNLEATSQPTFPSSVTNSTHSLLPGTENSGYFRGSYSNSPSNPVNSRANQDFSALMRSSYHCAMNNE Predict reactive species\nFull Name: baculoviral IAP repeat-containing 3\nCalculated Molecular Weight: 604 aa, 68 kDa\nObserved Molecular Weight: 68 kDa\nGenBank Accession Number: BC027485\nGene Symbol: cIAP2\nGene ID (NCBI): 330\nRRID: AB_2879485\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q13489\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868875935913,"sku":"24304-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-24304-1-ap","provider":"Iright","version":"1.0","type":"link"}