{"product_id":"proteintech-24320-1-ap","title":"Proteintech, 24320-1-AP, DGKB Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DGKB (24320-1-AP) by Proteintech is a Polyclonal antibody targeting DGKB in WB, IHC, ELISA applications with reactivity to human samples\n24320-1-AP targets DGKB in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells\nPositive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:100-1:400\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDGKB(Diacylglycerol kinase beta) is also named as DAGK2, KIAA0718 , 90 kDa diacylglycerol kinase and belongs to the eukaryotic diacetylglycerol kinase family. It is a key enzyme in lipid metabolism that functions to reintroduce diacylglycerol formed from the hydrolysis of phospholipids into the biosynthetic pathway. This protein has 2 isoforms produced by alternative splicing with the molecular weight of 87 kDa and 91 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag19809 Product name: Recombinant human DGKB protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 30-140 aa of BC105005 Sequence: KDVLEEFHGNGVLAKYNPEGKQDILNQTIDFEGFKLFMKTFLEAELPDDFTAHLFMSFSNKFPHSSPMVKSKPALLSGGLRMNKGAITPPRTTSPANTCSPEVIHLKDIVC Predict reactive species\nFull Name: diacylglycerol kinase, beta 90kDa\nCalculated Molecular Weight: 804 aa, 91 kDa\nObserved Molecular Weight: 91 kDa\nGenBank Accession Number: BC105005\nGene Symbol: DGKB\nGene ID (NCBI): 1607\nRRID: AB_2879492\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y6T7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887186268329,"sku":"24320-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-24320-1-ap","provider":"Iright","version":"1.0","type":"link"}