{"product_id":"proteintech-24395-1-ap","title":"Proteintech, 24395-1-AP, MLK4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MLK4 (24395-1-AP) by Proteintech is a Polyclonal antibody targeting MLK4 in WB, IF\/ICC, ELISA applications with reactivity to human,   mouse,  rat samples\n24395-1-AP targets MLK4 in WB, IF\/ICC, ELISA applications and shows reactivity with human,   mouse,  rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells\nPositive IF\/ICC detected in: C6 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:10-1:100\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMLK4 belongs to the MAP kinase kinase kinase subfamily. The MLK family members are characterized by the presence of signature sequences ofSer\/Thr and Tyr kinases within their catalytic domain. The MLK1-4 contains an aminoterminal Src-Homology (SH3) domain, followed by the kinase domain, a leucine-zipper region, and a Cdc42\/Rac-interactive binding (CRIB) motif. MLK4 expressed in two splicing variants, MLK4α and MLK4β. The difference of these two isoforms is located in their C-terminal portion. The negative effect of MLK4 on LPS-induced ERK and JNK activation could be very important in controlling the level of cytokine expression, and thus maintaining the balance of inflammatory responses.(PMID:21602844). This protein has 3 isoforms produced by alternative splicing with the molecular weight of 63 kDa, 113 kDa, 53 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18904 Product name: Recombinant human KIAA1804 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 689-1036 aa of BC136649 Sequence: WEEAASANAATVSIEMTPTNSLSRSPQRKKTESALYGCTVLLASVALGLDLRELHKAQAAEEPLPKEEKKKREGIFQRASKSRRSASPPTSLPSTCGEASSPPSLPLSSALGILSTPSFSTKCLLQMDSEDPLVDSAPVTCDSEMLTPDFCPTAPGSGREPALMPRLDTDCSVSRNLPSSFLQQTCGNVPYCASSKHRPSHHRRTMSDGNPTPTGATIISATGASALPLCPSPAPHSHLPREVSPKKHSTVHIVPQRRPASLRSRSDLPQAYPQTAVSQLAQTACVVGRPGPHPTQFLAAKERTKSHVPSLLDADVEGQSRDYTVPLCRMRSKTSRPSIYELEKEFLS Predict reactive species\nFull Name: mixed lineage kinase 4\nCalculated Molecular Weight: 1036 aa, 114 kDa\nObserved Molecular Weight: 53 kDa\nGenBank Accession Number: BC136649\nGene Symbol: MLK4\nGene ID (NCBI): 84451\nRRID: AB_2879522\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q5TCX8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887720255657,"sku":"24395-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-24395-1-ap","provider":"Iright","version":"1.0","type":"link"}