{"product_id":"proteintech-24412-1-ap","title":"Proteintech, 24412-1-AP, ATG14\/Barkor (C-terminal) Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ATG14\/Barkor (C-terminal) (24412-1-AP) by Proteintech is a Polyclonal antibody targeting ATG14\/Barkor (C-terminal) in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n24412-1-AP targets ATG14\/Barkor (C-terminal) in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, HeLa cells\nPositive IHC detected in: human brain tissue,  human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nBarkor, also named as ATG14, Atg14L and KIAA0831, is named as Beclin 1-associated autophagy-related key regulator protein. The function of Barkor in autophagy has been manifested in several assays, including stress-induced LC3 lipidation, autophagosome formation, and Salmonella typhimurium amplification. A major band around 65-68 kDa and a light band around 42 kDa can be observed in western blot which may be caused by alternative splicing of ATG14. The specificity of ATG14 antibody has been tested by siRNA test.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag19707 Product name: Recombinant human Barkor protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 152-406 aa of BC109090 Sequence: YSRAQRHQEKKEKIQRHNRKLGDLVEKKTIDLRSHYERLANLRRSHILELTSVIFPIEEVKTGVRDPADVSSESDSAMTSSTVSKLAEARRTTYLSGRWVCDDHNGDTSISITGPWISLPNNGDYSAYYSWVEEKKTTQGPDMEQSNPAYTISAALCYATQLVNILSHILDVNLPKKLCNSEFCGENLSKQKFTRAVKKLNANILYLCFSQHVNLDQLQPLHTLRNLMYLVSPSSEHLGRSGPFEVRADLEESME Predict reactive species\nFull Name: KIAA0831\nCalculated Molecular Weight: 492 aa, 55 kDa\nObserved Molecular Weight: 65-68 kDa, 42 kDa\nGenBank Accession Number: BC109090\nGene Symbol: ATG14\nGene ID (NCBI): 22863\nRRID: AB_2879531\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q6ZNE5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868977287337,"sku":"24412-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-24412-1-ap","provider":"Iright","version":"1.0","type":"link"}