{"product_id":"proteintech-24419-1-ap","title":"Proteintech, 24419-1-AP, FAM48A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FAM48A (24419-1-AP) by Proteintech is a Polyclonal antibody targeting FAM48A in WB, IHC, ELISA applications with reactivity to human samples\n24419-1-AP targets FAM48A in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: PC-3 cells,  Jurkat cells\nPositive IHC detected in: mouse testis tissue, human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFAM48A also named as C13orf19 or SUPT20H is a 779 amino acid protein, which belongs to the SPT20 family. FAM48A is required for MAP kinase p38 activation during gastrulation and for starvation-induced ATG9A trafficking during autophagy. FAM48A localizes in the nucleus and is highly expressed in testis, moderately in brain and pituitary gland.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag19875 Product name: Recombinant human FAM48A protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 482-701 aa of BC030686 Sequence: TPQQTSSFLKSPTPPPSSKPSSIPRKSSVDLNQVSMLSPAALSPASSSQRTTATQVMANSAGLNFINVVGSVCGAQALMSGSNPMLGCNTGAITPAGINLSGLLPSGGLLPNALPSAMQAASQAGVPFGLKNTSSLRPLNLLQLPGGSLIFNTLQQQQQQLSQFTPQQPQQPTTCSPQQPGEQGSEQGSTSQEQALSAQQAAVINLTGVGSFMQSQAAVL Predict reactive species\nFull Name: family with sequence similarity 48, member A\nCalculated Molecular Weight: 779 aa, 86 kDa\nObserved Molecular Weight: 86 kDa\nGenBank Accession Number: BC030686\nGene Symbol: FAM48A\nGene ID (NCBI): 55578\nRRID: AB_2879537\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8NEM7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887633027241,"sku":"24419-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-24419-1-ap","provider":"Iright","version":"1.0","type":"link"}