{"product_id":"proteintech-24430-1-ap","title":"Proteintech, 24430-1-AP, RS1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RS1 (24430-1-AP) by Proteintech is a Polyclonal antibody targeting RS1 in WB, IHC, IF-P, IF-Fro, ELISA applications with reactivity to human, mouse, rat samples\n24430-1-AP targets RS1 in WB, IHC, IF-P, IF-Fro, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat retina tissue, mouse eye tissue\nPositive IHC detected in: mouse eye tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse eye tissue\nPositive IF-Fro detected in: mouse eye tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\nImmunofluorescence (IF)-FRO: IF-FRO : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRS1 is also named as XLRS1. RS1 can bind negatively charged membrane lipids, such as phosphatidylserine and phosphoinositides. RS1 is required for normal structure and function of the retina (PMID:19093009). It may play a role in cell-cell adhesion processes in the retina (PMID:27114531). RS1 is high expression in the retina (at protein level) (PMID:10915776, PMID:9326935). It is detected in the inner segment of the photoreceptors, the inner nuclear layer, the inner plexiform layer and the ganglion cell layer. At the macula, it is expressed in both the outer and inner nuclear layers and in the inner plexiform layer (PMID:10915776, PMID:10915776). And RS1 is undetectable in the inner plexiform layers and the inner nuclear layer (PMID:10915776)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18885 Product name: Recombinant human RS1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 25-224 aa of BC141638 Sequence: TEDEGEDPWYQKACKCDCQGGPNALWSAGATSLDCIPECPYHKPLGFESGEVTPDQITCSNPEQYVGWYSSWTANKARLNSQGFGCAWLSKFQDSSQWLQIDLKEIKVISGILTQGRCDIDEWMTKYSVQYRTDERLNWIYYKDQTGNNRVFYGNSDRTSTVQNLLRPPIISRFIRLIPLGWHVRIAIRMELLECVSKCA Predict reactive species\nFull Name: retinoschisin 1\nCalculated Molecular Weight: 26 kDa\nObserved Molecular Weight: 26 kDa\nGenBank Accession Number: BC141638\nGene Symbol: RS1\nGene ID (NCBI): 6247\nRRID: AB_2879545\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O15537\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869495546025,"sku":"24430-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-24430-1-ap","provider":"Iright","version":"1.0","type":"link"}