{"product_id":"proteintech-24435-1-ap","title":"Proteintech, 24435-1-AP, L3MBTL2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe L3MBTL2 (24435-1-AP) by Proteintech is a Polyclonal antibody targeting L3MBTL2 in WB, ELISA applications with reactivity to human samples\n24435-1-AP targets L3MBTL2 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: U2OS cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nL3MBTL2 (Lethal (3) malignant brain tumor like 2) is a member of the MBT-domain proteins, which are involved in transcriptional repression and implicated in chromatin compaction. L3MBTL2 was most highly expressed in pachytene spermatocytes within the testis (PMID: 30760872).In addition, mutations in L3MBTL2 are prevalent in various cancers including leukemia, a disease characterized by alterations in multiple DNA repair proteins (PMID: 29581593).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag19571 Product name: Recombinant human L3MBTL2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 284-427 aa of BC017191 Sequence: RTIHAKFTDWKGYLMKRLVGSRTLPVDFHIKMVESMKYPFRQGMRLEVVDKSQVSRTRMAVVDTVIGGRLRLLYEDGDSDDDFWCHMWSPLIHPVGWSRRVGHGIKMSERRSDMAHHPTFRKIYCDAVPYLFKKVRAVYTEGGW Predict reactive species\nFull Name: l(3)mbt-like 2 (Drosophila)\nCalculated Molecular Weight: 705 aa, 79 kDa\nObserved Molecular Weight: 95-100 kDa\nGenBank Accession Number: BC017191\nGene Symbol: L3MBTL2\nGene ID (NCBI): 83746\nRRID: AB_3085733\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q969R5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887700201641,"sku":"24435-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-24435-1-ap","provider":"Iright","version":"1.0","type":"link"}