{"product_id":"proteintech-24474-1-ap","title":"Proteintech, 24474-1-AP, C1QBP Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe C1QBP (24474-1-AP) by Proteintech is a Polyclonal antibody targeting C1QBP in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n24474-1-AP targets C1QBP in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: C2C12 cells, HEK-293 cells,  HCT 116 cells,  HeLa cells,  K-562 cells,  NIH\/3T3 cells,  PC-12 cells,  RAW 264.7 cells\nPositive IHC detected in: human tonsillitis tissue, human breast cancer tissue,  mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: NIH\/3T3 cells, HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nC1QBP, also named as gC1q receptor (gC1qR), p32, p33, and hyaluronan-binding protein 1 (HABP1), is a protein initially copurified with splicing factor SF2 (PMID: 1830244). The protein is synthesized as a pro-protein of 282 amino acids (aa) that is post-translationally processed by removal of the initial 73 aa to a mature protein of 209 aa (PMID: 8262387). C1QBP is an evolutionary conserved and ubiquitously expressed multifunctional protein and has been reported to be a predominantly mitochondrial matrix protein involved in inflammation and infection processes, mitochondrial ribosome biogenesis, regulation of apoptosis and nuclear transcription, and pre-mRNA splicing (PMID: 28942965).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag19773 Product name: Recombinant human C1QBP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-282 aa of BC013731 Sequence: MLPLLRCVPRVLGSSVAGLRAAAPASPFRQLLQPAPRLCTRPFGLLSVRAGSERRPGLLRPRGPCACGCGCGSLHTDGDKAFVDFLSDEIKEERKIQKHKTLPKMSGGWELELNGTEAKLVRKVAGEKITVTFNINNSIPPTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVIKNDDGKKALVLDCHYPEDEVGQEDEAESDIFSIREVSFQSTGESEWKDTNYTLNTDSLDWALYDHLMDFLADRGVDNTFADELVELSTALEHQEYITFLEDLKSFVKSQ Predict reactive species\nFull Name: complement component 1, q subcomponent binding protein\nCalculated Molecular Weight: 282 aa, 31 kDa\nObserved Molecular Weight: 32-35 kDa\nGenBank Accession Number: BC013731\nGene Symbol: C1QBP\nGene ID (NCBI): 708\nRRID: AB_2827427\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q07021\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868910440617,"sku":"24474-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-24474-1-ap","provider":"Iright","version":"1.0","type":"link"}