{"product_id":"proteintech-24478-1-ap","title":"Proteintech, 24478-1-AP, OPN4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe OPN4 (24478-1-AP) by Proteintech is a Polyclonal antibody targeting OPN4 in IF-P, ELISA applications with reactivity to human, mouse samples\n24478-1-AP targets OPN4 in IF-P, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IF-P detected in: mouse eye tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nOPN4, an opsin that was first isolated from the skin of Xenopus laevis in 1998, belongs not to the vertebrate-type opsin family but rather to the invertebrate-type opsins, which are part of the seven-transmembrane G protein-coupled receptor (GPCR) family (PMID:31989708). In humans, OPN4 is expressed in the retinal ganglion cells in addition to part of the brain (PMID:10632589). Moreover, Opn4 functions as a photoreceptor by detecting brightness levels and discriminating visual signals (PMID:22633808). Opn4 also facilitates visual circuits to acquire optimal settings and light adaptation by measuring irradiance levels (PMID:25517373).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag21643 Product name: Recombinant human OPN4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 356-478 aa of BC113558 Sequence: KYRVAIAQHLPCLGVLLGVSRRHSRPYPSYRSTHRSTLTSHTSNLSWISIRRRQESLGSESEVGWTHMEAAAVWGAAQQANGRSLYGQGLEDLEAKAPPRPQGHEAETPGKTKGLIPSQDPRM Predict reactive species\nFull Name: opsin 4\nCalculated Molecular Weight: 478 aa, 53 kDa\nGenBank Accession Number: BC113558\nGene Symbol: OPN4\nGene ID (NCBI): 94233\nRRID: AB_3085736\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UHM6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887746207913,"sku":"24478-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-24478-1-ap","provider":"Iright","version":"1.0","type":"link"}