{"product_id":"proteintech-24495-1-ap","title":"Proteintech, 24495-1-AP, IL-17B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe IL-17B (24495-1-AP) by Proteintech is a Polyclonal antibody targeting IL-17B in WB, ELISA applications with reactivity to human samples\n24495-1-AP targets IL-17B in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Daudi cells, HeLa cells,  MOLT-4 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe interleukin (IL)-17 superfamily, a relatively new family of cytokines, consists of six ligands (from IL-17A to IL-17F), which bind to five receptor subtypes (from IL-17RA to IL-17RE) and induce downstream signaling. IL-17B was originally described as increased during intestinal inflammation. Moreover, it stimulates TNF-α and IL-1β production by the human monocytic leukemia THP-1 cells and promotes neutrophil migration upon intraperitoneal administration, suggesting a pro-inflammatory role. More recent findings strongly suggest a role for the IL-17B\/IL-17RB pathway in tumorigenesis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag21453 Product name: Recombinant human IL-17B protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 23-180 aa of BC113925 Sequence: RSPKSKRKGQGRPGPLAPGPHQVPLDLVSRMKPYARMEEYERNIEEMVAQLRNSSELAQRKCEVNLQLWMSNKRSLSPWGYSINHDPSRIPVDLPEARCLCLGCVNPFTMQEDRSMVSVPVFSQVPVRRRLCPPPPRTGPCRQRAVMETIAVGCTCIF Predict reactive species\nFull Name: interleukin 17B\nCalculated Molecular Weight: 180 aa, 20 kDa\nObserved Molecular Weight: 24 kDa\nGenBank Accession Number: BC113925\nGene Symbol: IL-17B\nGene ID (NCBI): 27190\nRRID: AB_3669439\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UHF5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887679262889,"sku":"24495-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-24495-1-ap","provider":"Iright","version":"1.0","type":"link"}