{"product_id":"proteintech-24513-1-ap","title":"Proteintech, 24513-1-AP, CPS1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CPS1 (24513-1-AP) by Proteintech is a Polyclonal antibody targeting CPS1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n24513-1-AP targets CPS1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, HeLa cells,  mouse liver tissue,  rat liver tissue,  L02 cells\nPositive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCarbamoyl phosphate synthetase 1 (CPS1) is the first rate-limiting enzyme in the urea cycle, converting ammonium into carbamoyl phosphate, and plays an intricate role in arginine metabolism and pyrimidine metabolism (PMID: 28376202). CPS1 expression is liver specific and suppressed in HCC cells and tumor tissues at the transcriptional level(PMID: 21281797). CPS1 gene comprises 38 exons that encode a polypeptide of 1500 amino acids and has a molecular weight of 165 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag21605 Product name: Recombinant human CPS1 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1361-1500 aa of BC140943 Sequence: GILIGIQQSFRPRFLGVAEQLHNEGFKLFATEATSDWLNANNVPATPVAWPSQEGQNPSLSSIRKLIRDGSIDLVINLPNNNTKFVHDNYVIRRTAVDSGIPLLTNFQVTKLFAEAVQKSRKVDSKSLFHYRQYSAGKAA Predict reactive species\nFull Name: carbamoyl-phosphate synthetase 1, mitochondrial\nCalculated Molecular Weight: 1500 aa, 165 kDa\nObserved Molecular Weight: 140-165 kDa\nGenBank Accession Number: BC140943\nGene Symbol: CPS1\nGene ID (NCBI): 1373\nRRID: AB_2879583\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P31327\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886840238249,"sku":"24513-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-24513-1-ap","provider":"Iright","version":"1.0","type":"link"}