{"product_id":"proteintech-24544-1-ap","title":"Proteintech, 24544-1-AP, ZBTB8A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ZBTB8A (24544-1-AP) by Proteintech is a Polyclonal antibody targeting ZBTB8A in WB, IF\/ICC, IP, ELISA applications with reactivity to human samples\n24544-1-AP targets ZBTB8A in WB, IF\/ICC, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells\nPositive IP detected in: HEK-293 cells\nPositive IF\/ICC detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nZBTB8A, also named as Zinc finger and BTB domain-containing protein 8A, is a 441 amino acid protein, which may be involved in transcriptional regulation. ZBTB8A may be a potential carcinogenic factor in gastric carcinoma, and may also be involved in gastric adenocarcinoma cell differentiation, cancer invasion and metastasis. The calcualted molecular weight of ZBTB8A is 50 kDa, but modified ZBTB8A is about 55-60 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag21588 Product name: Recombinant human ZBTB8A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 106-296 aa of BC015239 Sequence: QMTDVISVCKTFIKSSLDISEKEKDRYFSLSDKDANSNGVERSSFYSGGWQEGSSSPRSHLSPEQGTGIISGKSWNKYNYHPASQKNTQQPLAKHEPRKESIKKTKHLRLSQPSEVTHYKSSKREVRTSDSSSHVSQSEEQAQIDAEMDSTPVGYQYGQGSDVTSKSFPDDLPRMRFKCPYCTHVVKRKAD Predict reactive species\nFull Name: zinc finger and BTB domain containing 8A\nCalculated Molecular Weight: 441 aa, 50 kDa\nObserved Molecular Weight: 55-60 kDa\nGenBank Accession Number: BC015239\nGene Symbol: ZBTB8A\nGene ID (NCBI): 653121\nRRID: AB_2879599\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96BR9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887927218345,"sku":"24544-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-24544-1-ap","provider":"Iright","version":"1.0","type":"link"}