{"product_id":"proteintech-24552-1-ap","title":"Proteintech, 24552-1-AP, CD41 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CD41 (24552-1-AP) by Proteintech is a Polyclonal antibody targeting CD41 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n24552-1-AP targets CD41 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse lung tissue, rat blood,  mouse spleen tissue,  rat spleen tissue,  human blood tissue\nPositive IP detected in: human plasma tissue\nPositive IHC detected in: mouse spleen tissue, human spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe integrins are a superfamily of cell adhesion receptors that bind to extracellular matrix ligands, cell-surface ligands, and soluble ligands (PMID: 17543136). They are transmembrane αβ heterodimers and at least 24 distinct integrin heterodimers are formed by the combination of 18 α and eight β known subunits (PMID: 17543136; 20029421). In addition to mediating cell adhesion, integrins also play important roles in modulating signal transduction pathways that control cellular responses including migration, proliferation, differentiation, and apoptosis (PMID: 19118207). Integrin alpha-IIb (ITGA2B, CD41) is expressed on platelets, megakaryocytes and some hematopoietic progenitor cells (PMID: 11934866). This protein undergoes post-translational cleavage to yield disulfide linked light beta (25 kDa) and heavy alpha (125 kDa) chains, which join with integrin beta3 (CD61) to form a receptor for fibronectin, fibrinogen, plasminogen, prothrombin, thrombospondin and vitronectin. CD41\/CD61 is crucial for platelet aggregation through binding of soluble fibrinogen.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag19459 Product name: Recombinant human CD41\/Integrin alpha 2b protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 678-894 aa of BC126442 Sequence: AELAVHLPQGAHYMRALSNVEGFERLICNQKKENETRVVLCELGNPMKKNAQIGIAMLVSVGNLEEAGESVSFQLQIRSKNSQNPNSKIVLLDVPVRAEAQVELRGNSFPASLVVAAEEGEREQNSLDSWGPKVEHTYELHNNGPGTVNGLHLSIHLPGQSQPSDLLYILDIQPQGGLQCFPQPPVNPLKVDWGLPIPSPSPIHPAHHKRDRRQIFL Predict reactive species\nFull Name: integrin, alpha 2b (platelet glycoprotein IIb of IIb\/IIIa complex, antigen CD41)\nCalculated Molecular Weight: 1039 aa, 113 kDa\nObserved Molecular Weight: 110-125 kDa\nGenBank Accession Number: BC126442\nGene Symbol: CD41\nGene ID (NCBI): 3674\nRRID: AB_2879604\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P08514\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868842086569,"sku":"24552-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-24552-1-ap","provider":"Iright","version":"1.0","type":"link"}