{"product_id":"proteintech-24560-1-ap","title":"Proteintech, 24560-1-AP, FYTTD1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FYTTD1 (24560-1-AP) by Proteintech is a Polyclonal antibody targeting FYTTD1 in WB, ELISA applications with reactivity to human samples\n24560-1-AP targets FYTTD1 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFYTTD1, also termed as UAP56 interacting factor or UIF, is a 318 amino acid protein, that belongs to the UIF family. FYTTD1 localizes to the nucleus and is required for mRNA export from the nucleus to the cytoplasm. Functioning as an adaptor, FYTTD1 utilizes the BAT1\/DDX39-TAP pathway, which is essential for efficient mRNA export and nuclear pore delivery. FYTTD1 interacts with SSRP1, a protein that is necessary for its recruitment of mRNAs, in addition to a mutually exclusive interaction with BAT1\/DDX39 and TAP. The molecular weight of post-translational modified FYTTD1 is observed to be 50 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag20051 Product name: Recombinant human FYTTD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 68-128 aa of BC039734 Sequence: MRVRWGIQQNSGFGKTSLNRRGRVMPGKRRPNGVITGLAARKTTGIRKGISPMNRPPLSDK Predict reactive species\nFull Name: forty-two-three domain containing 1\nCalculated Molecular Weight: 318 aa, 36 kDa\nObserved Molecular Weight: 50 kDa\nGenBank Accession Number: BC039734\nGene Symbol: FYTTD1\nGene ID (NCBI): 84248\nRRID: AB_2879609\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96QD9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887645085865,"sku":"24560-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-24560-1-ap","provider":"Iright","version":"1.0","type":"link"}