{"product_id":"proteintech-24576-1-ap","title":"Proteintech, 24576-1-AP, RIM1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RIM1 (24576-1-AP) by Proteintech is a Polyclonal antibody targeting RIM1 in WB, IP, IHC, ELISA applications with reactivity to human,  mouse,  rat samples\n24576-1-AP targets RIM1 in WB, IP, IHC, ELISA applications and shows reactivity with human,  mouse,  rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue\nPositive IP detected in: mouse brain tissue\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRIMS1 is a RAS gene superfamily member that regulates synaptic vesicle exocytosis. RIMS1 also plays a role in the regulation of voltage-gated calcium channels during neurotransmitter and insulin release. Mutations in RIMS1 have suggested a role cognition and have been identified as the cause of cone-rod dystrophy type 7.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag20161 Product name: Recombinant human RIMS1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 923-1039 aa of BC152435 Sequence: KSTTLTVPEQQRTTHHRSRSVSPHRGNDQGKPRSRLPNVPLQRSLDEIHPTRRSRSPTRHHDASRSPVDHRTRDVDSQYLSEQDSELLMLPRAKRGRSAECLHTTR Predict reactive species\nFull Name: regulating synaptic membrane exocytosis 1\nCalculated Molecular Weight: 1692 aa, 189 kDa\nObserved Molecular Weight: 189 kDa\nGenBank Accession Number: BC152435\nGene Symbol: RIMS1\nGene ID (NCBI): 22999\nRRID: AB_2879618\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q86UR5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868987805865,"sku":"24576-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-24576-1-ap","provider":"Iright","version":"1.0","type":"link"}