{"product_id":"proteintech-24582-1-ap","title":"Proteintech, 24582-1-AP, SLC37A1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC37A1 (24582-1-AP) by Proteintech is a Polyclonal antibody targeting SLC37A1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n24582-1-AP targets SLC37A1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse kidney tissue, MCF-7 cells,  rat kidney tissue\nPositive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSLC37A1 (also known as SPX1) is one of the SLC37 family members, localized in the endoplasmic reticulum (ER) membrane (PMID:29719821). The SLC37A1 protein also shares 30% sequence identity to GlpT, suggesting that SLC37A1 could be a mammalian glycerol-3-phosphate transporter. The SLC37A1 gene is widely expressed, with the highest transcript levels in adult kidney, bone marrow, intestine, spleen, and liver (PMID:24745989). In addition, the SLC37A1 protein shares 59% homology to SLC37A2, 35% homology to SLC37A3, and 22% homology to SLC37A4 (PMID:23506893). SLC37A1 is a 533 amino-acid protein with a calculated molecular weight of 58 kDa and observed molecular weight 60-66kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag20180 Product name: Recombinant human SLC37A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 247-336 aa of BC152997 Sequence: DVRCSSTLVTHSKGYENGTNRLRLQKQILKSEKNKPLDPEMQCLLLSDGKGSIHPNHVVILPGDGGSGTAAISFTGALKIPGVIEFSLCL Predict reactive species\nFull Name: solute carrier family 37 (glycerol-3-phosphate transporter), member 1\nCalculated Molecular Weight: 533 aa, 58 kDa\nObserved Molecular Weight: 60-66 kDa\nGenBank Accession Number: BC152997\nGene Symbol: SLC37A1\nGene ID (NCBI): 54020\nRRID: AB_2879621\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P57057\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887806435497,"sku":"24582-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-24582-1-ap","provider":"Iright","version":"1.0","type":"link"}