{"product_id":"proteintech-24583-1-ap","title":"Proteintech, 24583-1-AP, PDZ-GEF2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PDZ-GEF2 (24583-1-AP) by Proteintech is a Polyclonal antibody targeting PDZ-GEF2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n24583-1-AP targets PDZ-GEF2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, mouse brain tissue,  HeLa cells\nPositive IHC detected in: mouse brain tissue, rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRAPGEF6, also named PDZ-GEF2 enables several functions, including GTP-dependent protein binding activity; guanyl-nucleotide exchange factor activity; and phosphatidic acid binding activity. It is also involved in microvillus assembly; positive regulation of GTPase activity; and protein localization to plasma membrane. Located in several cellular components, including apical plasma membrane; centrosome; and endocytic vesicle.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag20325 Product name: Recombinant human PDZ-GEF2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-164 aa of BC142964 Sequence: MNSPVDPGARQALRKKPPERTPEDLNTIYSYLHGMEILSNLREHQLRLMSARARYERYSGNQVLFCSETIARCWYILLSGSVLVKGSMVLPPCSFGKQFGGKRGCDCLVLEPSEMIVVENAKDNEDSILQREIPARQSRRRFRKINYKGERQTITDDVEVNSYL Predict reactive species\nFull Name: Rap guanine nucleotide exchange factor (GEF) 6\nCalculated Molecular Weight: 1601 aa, 179 kDa\nObserved Molecular Weight: 179 kDa\nGenBank Accession Number: BC142964\nGene Symbol: RAPGEF6\nGene ID (NCBI): 51735\nRRID: AB_3085740\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8TEU7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887756464297,"sku":"24583-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-24583-1-ap","provider":"Iright","version":"1.0","type":"link"}